DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Gzmk

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:275 Identity:78/275 - (28%)
Similarity:115/275 - (41%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEH 123
            |.:.:|.|..   |:.|...:|...||.|.:.:|.     |..|||.||..:.|||||||:...|
  Rat    16 YMSSESFHTE---IIGGREVQPHSRPFMASIQYRG-----KHICGGVLIHPQWVLTAAHCYSRGH 72

  Fly   124 GEVNVVRLGELEFDTDTDDAEP--EDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPA 186
            ....|:....|..:      ||  :.|.:.......||::..  |||.:::|....:.|  ||..
  Rat    73 SPTVVLGAHSLSKN------EPMKQTFEIKEFIPFSGFKSGT--NDIMLIKLRTAAELN--KHVQ 127

  Fly   187 CLP------FDDGEQHESFIAIGWGQKK---FAQKESKKLLKVQLQGYKDRCVSSVDANDELPNG 242
            .|.      ..||.:.:   ..|||..|   ....::.:.:.|.:...| ||      |.:....
  Rat   128 LLHLRSKNYIRDGTKCQ---VTGWGSTKPDVLTTSDTLQEVTVTIISRK-RC------NSQSYYN 182

  Fly   243 YEP---KSQLCIGS-RDNKDTCNGDSGGPVLAYHKDLAC--MYHVMGITSAGITCSTPDIPSAYT 301
            ::|   |..:|.|. |..||:|.||||||       |.|  ::|  .:.|.|..|...:.|..||
  Rat   183 HKPVITKDMICAGDRRGEKDSCKGDSGGP-------LICKGVFH--ALVSGGYKCGISNKPGVYT 238

  Fly   302 RV-HYFLNWIKGELA 315
            .: ..:..|||.:||
  Rat   239 LLTKKYQTWIKSKLA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 71/256 (28%)
Tryp_SPc 72..310 CDD:214473 70/255 (27%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 70/259 (27%)
Tryp_SPc 26..251 CDD:238113 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.