DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG33461

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:312 Identity:87/312 - (27%)
Similarity:129/312 - (41%) Gaps:65/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPL---------------IVDGTPAEPK 81
            :.|.:.|.|:    ..::.|          |...|||..:               |::||||...
  Fly     1 MPCLEMKTII----AYLALF----------VLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLG 51

  Fly    82 EFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAE-- 144
            .:|:.|.| |..|    .:.|.|:||:...|||:|||.  |.....:.||||...|.|.|...  
  Fly    52 RYPWMAFL-HTPT----YFLCAGSLINQWFVLTSAHCI--EDDVELIARLGENNRDNDIDCENNR 109

  Fly   145 ----PEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDG------EQHESF 199
                .:::.|..|..|..::.....||||:::|:|.|::..:..|.|: |...      :|...|
  Fly   110 CLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICI-FHHRRMQLVVDQITWF 173

  Fly   200 IAIGWG--QKKFAQKESKKLLKVQL-QGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCN 261
            .|.|||  ......|.|:.|:::.| :..::.|......|  ..:|     |:|.|: |:.:.|.
  Fly   174 KATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQN--FLSG-----QICAGN-DDGNLCR 230

  Fly   262 GDSGGPVLAYHKDLACMYHV-MGITSAGI-TCSTPDIPSAYTRVHYFLNWIK 311
            ||||||...|.........| |||.|... .||...|   .|.|..:..|||
  Fly   231 GDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSKVSI---LTDVVRYGRWIK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 77/255 (30%)
Tryp_SPc 72..310 CDD:214473 76/254 (30%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 76/255 (30%)
Tryp_SPc 42..281 CDD:238113 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.