DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Sp212

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:252 Identity:69/252 - (27%)
Similarity:117/252 - (46%) Gaps:26/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGEL 134
            |.||.|......::|:.:.:.|::. ..:.:.|.|:|||:.:|::||||......:..||.||..
  Fly   275 PFIVRGNEFPRGQYPWLSAVYHKEV-RALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRY 338

  Fly   135 EFDTDTDDAEPEDFGVLALKAHPGFENPQLYN--DIGIVQLDREVKFNRYKHPACLPFDDGEQHE 197
            :.|...:|. .|...|:.|..||.: |.:.|:  ||.::.::|.|.||....|.|:...:..:..
  Fly   339 DLDDYGEDG-AEMRNVMRLLWHPDY-NTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTV 401

  Fly   198 S---FIAIGWGQKKFAQK-ESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKD 258
            |   ||| |||:.:.:.: :..::::.::.. ...|.|:....      ...:..||.|:||...
  Fly   402 STTGFIA-GWGRDEDSSRTQYPRVVEAEIAS-PTVCASTWRGT------MVTERSLCAGNRDGSG 458

  Fly   259 TCNGDSGGPVLAYHKDLACMYHVMGITSAGI-----TCSTPDIPSAYTRVHYFLNWI 310
            .|.|||||.::....|   .:.:.||.|||.     ||..... ..|..:...:|||
  Fly   459 PCVGDSGGGLMVKQGD---RWLLRGIVSAGERGPAGTCQLNQY-VLYCDLSKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 68/250 (27%)
Tryp_SPc 72..310 CDD:214473 66/248 (27%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 68/250 (27%)
Tryp_SPc 277..511 CDD:214473 66/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.