DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Sp212

DIOPT Version :10

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:252 Identity:69/252 - (27%)
Similarity:117/252 - (46%) Gaps:26/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGEL 134
            |.||.|......::|:.:.:.|::. ..:.:.|.|:|||:.:|::||||......:..||.||..
  Fly   275 PFIVRGNEFPRGQYPWLSAVYHKEV-RALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRY 338

  Fly   135 EFDTDTDDAEPEDFGVLALKAHPGFENPQLYN--DIGIVQLDREVKFNRYKHPACLPFDDGEQHE 197
            :.|...:|. .|...|:.|..||.: |.:.|:  ||.::.::|.|.||....|.|:...:..:..
  Fly   339 DLDDYGEDG-AEMRNVMRLLWHPDY-NTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTV 401

  Fly   198 S---FIAIGWGQKKFAQK-ESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKD 258
            |   ||| |||:.:.:.: :..::::.::.. ...|.|:....      ...:..||.|:||...
  Fly   402 STTGFIA-GWGRDEDSSRTQYPRVVEAEIAS-PTVCASTWRGT------MVTERSLCAGNRDGSG 458

  Fly   259 TCNGDSGGPVLAYHKDLACMYHVMGITSAGI-----TCSTPDIPSAYTRVHYFLNWI 310
            .|.|||||.::....|   .:.:.||.|||.     ||..... ..|..:...:|||
  Fly   459 PCVGDSGGGLMVKQGD---RWLLRGIVSAGERGPAGTCQLNQY-VLYCDLSKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 68/250 (27%)
Sp212NP_996209.2 GD_N 23..127 CDD:464985
Tryp_SPc 277..514 CDD:238113 68/250 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.