DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG30286

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:254 Identity:76/254 - (29%)
Similarity:119/254 - (46%) Gaps:37/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGEL----EFDT 138
            |...|.|:.|.| |:  :.|:  .|||||:::|.:||||||.  ...|...|||||.    ..|.
  Fly    41 AHISESPWMAYL-HK--SGEL--VCGGTLVNHRFILTAAHCI--REDENLTVRLGEFNSLTSIDC 98

  Fly   139 DTDDAEP--EDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDG-----EQH 196
            :..|..|  |||.:.....|.|:......:|||:::|.:.|::..:..|.||..:..     |:.
  Fly    99 NGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERL 163

  Fly   197 ESFIAIGWGQK-KFAQKESKKLLKVQLQGYKDRCVSS--VDANDELPNGYEPKSQLCIGSRDNKD 258
            ...:|.|||:. ..|.....|.::|....: ..|..:  ||..         :.|:|: |.::..
  Fly   164 HRLVATGWGRSPSEAANHILKSIRVTRVNW-GVCSKTYWVDRR---------RDQICV-SHESGV 217

  Fly   259 TCNGDSGGPV-LAYHKDLACMYHVMGITSAG-ITCSTPDIPSAYTRVHYFLNWIKGELA 315
            :|:||||||: .|...|...::..:||.|.| ..|.:   ||.:|.|...::||...|:
  Fly   218 SCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLS---PSVFTNVMEHIDWIMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 74/248 (30%)
Tryp_SPc 72..310 CDD:214473 73/247 (30%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 74/248 (30%)
Tryp_SPc 39..268 CDD:214473 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.