DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG30187

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:228 Identity:71/228 - (31%)
Similarity:104/228 - (45%) Gaps:31/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGF 159
            :|...:.||||||..|.|||||||...:  :|..|.||..   ..:|.|:.:|  |:....|..|
  Fly    54 HNRTHFICGGTLIHKRFVLTAAHCIVDQ--DVQSVSLGAY---NKSDPADRKD--VITAVVHSSF 111

  Fly   160 ENPQLY-NDIGIVQLDREVKFNRYKHPACLPFDDG-----EQHESFIAIGWGQKKFAQKESKKLL 218
            :....| ||||:::|..:|.||....|.|:..:..     ....:|.|.|||..:  ..::..:|
  Fly   112 DVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLR--GNKTSDIL 174

  Fly   219 KVQLQGYKDR--CVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVL--AYHKDLACMY 279
            :..:..:.||  |...:..       |..:.|:|.|. .:.|||.||||||:.  .:.:.:....
  Fly   175 QTIILNHLDREECYMELSV-------YPSEKQICAGV-PSGDTCGGDSGGPLTNDVFIQGIGNRE 231

  Fly   280 HVMGITSAGIT-CSTPDIPSAYTRVHYFLNWIK 311
            ...||.|.|.| |   |....||.:..|.:|||
  Fly   232 VQFGIISVGKTSC---DGQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 69/226 (31%)
Tryp_SPc 72..310 CDD:214473 68/225 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 68/225 (30%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.