DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG30090

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:265 Identity:83/265 - (31%)
Similarity:128/265 - (48%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEF 136
            |:.|..|.....|:.|.:     ::.:|..||||||:.|.|||||||.  ..|....|||||.: 
  Fly    40 IIGGRDAIINSNPWMAYI-----HSSVKLICGGTLITQRFVLTAAHCV--NEGSAVKVRLGEYD- 96

  Fly   137 DTDTDD---------AEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDD 192
            ||.|:|         ||..|.. :|.: |..|...:..|||.:::|.:.|.|..:..|.|:....
  Fly    97 DTATEDCNSKICIPRAEEHDVD-MAFR-HGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGT 159

  Fly   193 GEQH-----ESFIAIGWGQKKFAQKESKKLLKV-QLQGY-KDRCVSSVDANDELPNGYEPKSQLC 250
            .::.     |.|:|.|||:.:  ...::.:|:: |||.| ..:|:.::       .....::|:|
  Fly   160 SKRELVDSIEWFVATGWGETR--THRTRGVLQITQLQRYNSSQCMQAL-------GRLVQQNQIC 215

  Fly   251 IGSRDNKDTCNGDSGGPVLAYHKDLACMYHV-MGITSAGI-TCSTPDIPSAYTRVHYFLNWIKGE 313
            .| |...||||||||||:....:.:..|..| .|:.|.|. .||...:   ||.|:.:.:||...
  Fly   216 AG-RLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIGV---YTDVYSYADWIATV 276

  Fly   314 LAKQT 318
            :.:.|
  Fly   277 VQQNT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 81/256 (32%)
Tryp_SPc 72..310 CDD:214473 80/255 (31%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 80/255 (31%)
Tryp_SPc 40..276 CDD:238113 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.