DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG30088

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:283 Identity:95/283 - (33%)
Similarity:135/283 - (47%) Gaps:38/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGG 104
            :|.:|:||.:|......::||:     .....||.|..|..|..||.|.|.:   ::||  .|||
  Fly    18 LVLQEQVAANFLIPSCGVSYES-----NVATRIVRGKEAMLKSAPFMAYLYY---SSEI--HCGG 72

  Fly   105 TLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTD----DAEP--EDFGVLALKAHPGFENPQ 163
            |:||:|.:||||||.    .....|||||.:...:.|    ...|  |:|.::....:..|:. .
  Fly    73 TIISSRYILTAAHCM----RPYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDR-F 132

  Fly   164 LYNDIGIVQLDREVKFNRYKHPACL---PFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGY 225
            |.|||.:::|.|.::||.:..|.||   |......|| |.|.||||.: ....:..|....|..|
  Fly   133 LANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE-FQAFGWGQTE-TNHSANVLQTTVLTRY 195

  Fly   226 KDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGP-VLAYHKDLACMYHVMGITSAG- 288
            .:|...||.:.....|      |||:|.: ..|||:|||||| |...:.|....|..:||.|.| 
  Fly   196 DNRHCRSVLSMPITIN------QLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGD 253

  Fly   289 ITCSTPDIPSAYTRVHYFLNWIK 311
            ..|.:|.:   ||.|..::.||:
  Fly   254 DKCQSPGV---YTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 87/249 (35%)
Tryp_SPc 72..310 CDD:214473 86/248 (35%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 86/249 (35%)
Tryp_SPc 45..273 CDD:238113 87/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.