DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and F10

DIOPT Version :10

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:251 Identity:78/251 - (31%)
Similarity:112/251 - (44%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEF 136
            ||.|...:..|.|:.|.|    .|.|.:.|||||::|...:||||||.:  ..:...||:|:.  
Human   235 IVGGQECKDGECPWQALL----INEENEGFCGGTILSEFYILTAAHCLY--QAKRFKVRVGDR-- 291

  Fly   137 DTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQ-----H 196
            :|:.::.......|..:..|..|.......||.:::|...:.|.....|||||..|..:     .
Human   292 NTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQ 356

  Fly   197 ESFIAIGWGQ--KKFAQKESKKLLKVQLQGYKDR--C---VSSVDANDELPNGYEPKSQLCIGSR 254
            ::.|..|:|:  :|..|....|:|:|.   |.||  |   .|.:...:....||:.|.:      
Human   357 KTGIVSGFGRTHEKGRQSTRLKMLEVP---YVDRNSCKLSSSFIITQNMFCAGYDTKQE------ 412

  Fly   255 DNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWI 310
               |.|.||||||.:...||   .|.|.||.|.|..|:.......||:|..||.||
Human   413 ---DACQGDSGGPHVTRFKD---TYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 78/251 (31%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:464251
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 78/251 (31%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.