DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and T22A3.6

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:206 Identity:36/206 - (17%)
Similarity:68/206 - (33%) Gaps:80/206 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FSLSSSLVQGQNPDPFAQ-----LACTK-----------FKQIVFEERVAISFFFTDAPITYETV 62
            |...::.|.|:...|:.|     |:..|           :.:::||:.   |.|||::.:...|.
 Worm   332 FGSKATSVSGKQCIPWTQATSEILSMVKVNSTSSGVYHMYHRLLFEDP---SQFFTESRLFMNTE 393

  Fly    63 DSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIK-------WFCGGTLIS--NRLVLTAAHC 118
            .||                      .|.:|:.:.|:|       :|....|:|  .:|......|
 Worm   394 ASC----------------------MLLNRRNSVEVKNSYKESPFFTNEKLVSEFEKLFQQGPGC 436

  Fly   119 FFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYK 183
            |..::..:        ||.:...:.|.|             :.|         .|.:.:.|.:.:
 Worm   437 FVKQNKTI--------EFQSCYTECESE-------------KKP---------TLTKPLCFEKNR 471

  Fly   184 HPACLPFDDGE 194
            :..|.|...|:
 Worm   472 YSICKPKRSGD 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 20/132 (15%)
Tryp_SPc 72..310 CDD:214473 20/132 (15%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.