DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Plau

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:326 Identity:87/326 - (26%)
Similarity:145/326 - (44%) Gaps:53/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QNPDP------FAQLACTKFKQIVFEERVAISFFFTDAPITYETVD----SCHGSRPL-----IV 73
            :|||.      :.|:...:|.|.......::|    ..|.:  :||    .| |.:.|     ||
Mouse   124 RNPDNQKRPWCYVQIGLRQFVQECMVHDCSLS----KKPSS--SVDQQGFQC-GQKALRPRFKIV 181

  Fly    74 DGTPAEPKEFP-FAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVN-VVRLGELEF 136
            .|...|.:..| |||.....|..:...:.|||:|||...|.:|||||.....:.| ||.||:.: 
Mouse   182 GGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQSK- 245

  Fly   137 DTDTDDAEPEDFGVLALKAHPGFENPQL--YNDIGIVQLDRE----VKFNRYKHPACLP--FDDG 193
            ::..:..|.: |.|..|..|..:....|  :|||.::::...    .:.:|.....|||  |.|.
Mouse   246 ESSYNPGEMK-FEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDA 309

  Fly   194 EQHESFIAIGWGQKK---FAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPK---SQLCIG 252
            .........|:|::.   :...::.|:..|:|..: ::|:.        |:.|..:   ..||..
Mouse   310 PFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSH-EQCMQ--------PHYYGSEINYKMLCAA 365

  Fly   253 SRDNK-DTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIKGELAK 316
            ..:.| |:|.||||||::.   ::.....:.||.|.|..|:..:.|..||||.:||:||:..:.:
Mouse   366 DPEWKTDSCKGDSGGPLIC---NIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDWIQSHIGE 427

  Fly   317 Q 317
            :
Mouse   428 E 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 73/255 (29%)
Tryp_SPc 72..310 CDD:214473 72/254 (28%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58
Kringle 71..152 CDD:333799 6/27 (22%)
Connecting peptide 153..179 7/32 (22%)
Tryp_SPc 180..424 CDD:238113 74/257 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.