DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and Plat

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_032898.2 Gene:Plat / 18791 MGIID:97610 Length:559 Species:Mus musculus


Alignment Length:329 Identity:90/329 - (27%)
Similarity:136/329 - (41%) Gaps:83/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVD-----SC---HGSRP--LIVDGTPA 78
            :|||..|:..|...|               |..:|:|..|     :|   ...||  .|..|...
Mouse   266 RNPDGDARPWCHVMK---------------DRKLTWEYCDMSPCSTCGLRQYKRPQFRIKGGLYT 315

  Fly    79 EPKEFPFAARL--GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFS----EHGEVNVVRL-----G 132
            :....|:.|.:  .::::..| ::.|||.|||:..||:|||||..    .|.:|.:.|.     |
Mouse   316 DITSHPWQAAIFVKNKRSPGE-RFLCGGVLISSCWVLSAAHCFLERFPPNHLKVVLGRTYRVVPG 379

  Fly   133 ELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKH----PACLP---- 189
            |          |.:.|.:.....|..|::....|||.::||..:.|....:.    .||||    
Mouse   380 E----------EEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQESSSVGTACLPDPNL 434

  Fly   190 -FDDGEQHESFIAIGWGQKKFAQK-ESKKLLKVQLQGY-KDRCVSSVDANDELPNGYEPKSQLCI 251
             ..|..:.|   ..|:|:.:.:.. .|.:|.:..::.| ..||.|....|..:.|     :.||.
Mouse   435 QLPDWTECE---LSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLFNKTVTN-----NMLCA 491

  Fly   252 ------GSRDNKDTCNGDSGGPVLAYHKDLACMYH----VMGITSAGITCSTPDIPSAYTRVHYF 306
                  |::|..|.|.||||||       |.||.:    :.||.|.|:.|...|:|..||:|..:
Mouse   492 GDTRSGGNQDLHDACQGDSGGP-------LVCMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNY 549

  Fly   307 LNWI 310
            |:||
Mouse   550 LDWI 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 77/271 (28%)
Tryp_SPc 72..310 CDD:214473 75/269 (28%)
PlatNP_032898.2 FN1 38..80 CDD:214494
Important for binding to annexin A2. /evidence=ECO:0000250 39..49
EGF 83..115 CDD:394967
Kringle 124..205 CDD:395005
KR 210..295 CDD:238056 10/43 (23%)
Tryp_SPc 311..556 CDD:238113 76/269 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.