DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and try-5

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:305 Identity:70/305 - (22%)
Similarity:111/305 - (36%) Gaps:75/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TKFK----QIVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEF-PFAARLGHRKT 94
            ||.|    ::...:....||..|||.                  |....|... |:|.::..:..
 Worm    19 TKLKYYNDELCGRQSTYTSFMLTDAA------------------GNTGNPTHLAPWAVQIRVKAR 65

  Fly    95 NNEIKWFCGGTLISNRLVLTAAHCF------FSEHGEVNVVRLGELEFDTDTDDAE--------- 144
            ..:.:..||||||:.:.||||||||      ..|.||.|.:.....|.:....|:|         
 Worm    66 KGDFEVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTV 130

  Fly   145 -------PEDFGVLALKAH------PGFENPQLY-------NDIGIVQLDREVKFNRYKHPACLP 189
                   .:.:|.:..|.:      ..|.....|       |||.|::|:..:......:.||||
 Worm   131 GAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGANYACLP 195

  Fly   190 F------DDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDAN--DELPNGYEPK 246
            |      ..|....||   |||.......::.....:|:.......:::.:.|  ..:     |.
 Worm   196 FLPEVNIQSGANVTSF---GWGSDPGKGFDNAAFPMIQVLTLATETLATCEENWGTSI-----PF 252

  Fly   247 SQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITC 291
            ...|....::|:.|:|||||. |.:|:..:....::.|.|.|..|
 Worm   253 DSFCTAEEEDKNVCSGDSGGG-LTFHQSDSAREFIIAIVSYGSDC 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/264 (23%)
Tryp_SPc 72..310 CDD:214473 62/264 (23%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 60/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.