DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and try-4

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:341 Identity:75/341 - (21%)
Similarity:117/341 - (34%) Gaps:109/341 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AISFFFTDAPITYETV---------------------DSCHGSRPLIVDGTPAEP--KEFPFAAR 88
            |:...||...||:|.|                     :||         |...|.  |.||:|..
 Worm     8 ALIIIFTVPVITFEPVWIGNAFSMESFQTIVDNEVLMESC---------GIQQESKIKNFPWAVS 63

  Fly    89 LGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHG------------EVNVVRLGELEFDTDT- 140
            ......|.     .||::||...::||||.|.:..|            :.|......::|..|| 
 Worm    64 FTVDGVNR-----LGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFLRDTR 123

  Fly   141 ------------DDAEPED-------------FGVL---------ALKAHPGFENPQLYNDIGIV 171
                        .|..|.|             ..||         .||.|          |..||
 Worm   124 KVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGH----------DWAIV 178

  Fly   172 QLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQL-------QGYKDRC 229
            ::::.:.|:....|.|||..:....:|....|||:.....:....:.::.:       :.:.||.
 Worm   179 EVEKRIHFSENVRPICLPRPNMYYTKSLAVPGWGRSYIFNESGPLIHEIPMRIDRDCKRPWSDRL 243

  Fly   230 VSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTP 294
              ..||:|     :...:.:.:.:.....||:|||||. |.|..|......::.|||.|......
 Worm   244 --PADADD-----FICATSMNVSNYSAPRTCHGDSGGG-LEYRDDNYGRAFLIAITSFGTRGCPS 300

  Fly   295 DIPSAYTRVHYFLNWI 310
            ::.:.:|||..:||.|
 Worm   301 NMLARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 66/295 (22%)
Tryp_SPc 72..310 CDD:214473 65/293 (22%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 65/289 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.