DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and try-10

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:290 Identity:65/290 - (22%)
Similarity:97/290 - (33%) Gaps:100/290 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILLLVF-SLSSSLVQGQNPDPFAQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLI 72
            ||||.| |.|:|::.|.:.:.|              :.::::...|..|                
 Worm    63 ILLLSFISYSTSIINGFSANSF--------------DTLSLASVITRFP---------------- 97

  Fly    73 VDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFS--EHGEVNVVRLGELE 135
             |||                 ||     .|||.||:..:|:|:|||.||  :......|.||::.
 Worm    98 -DGT-----------------TN-----VCGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLGDVH 139

  Fly   136 FDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPAC----------LPF 190
            .:.. ||.|.|      .::|....:.:.:||......|..|.|...:...|          ||.
 Worm   140 LNKH-DDGEQE------FRSHAMAISKKFFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPS 197

  Fly   191 DDG--------------EQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPN 241
            ...              |....::| |||      |...|..|     |.| .|..:..|..:..
 Worm   198 TGSVNFKETAPLTQLQLETSVCYVA-GWG------KTENKTAK-----YSD-SVRQMMVNLSVRR 249

  Fly   242 GYEPKSQLCIGSRDNKDTCNGDSGGPVLAY 271
            ..:.|..:......:...|.||||.||..:
 Worm   250 IGKRKYLIAKAVTGSSRACMGDSGSPVYCF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 53/226 (23%)
Tryp_SPc 72..310 CDD:214473 53/226 (23%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 57/278 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.