DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and try-1

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:277 Identity:82/277 - (29%)
Similarity:118/277 - (42%) Gaps:54/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PITYETVDSCHGSRPLIVDGTPAEPKEFPFA----ARLGHRKTNNEIKWFCGGTLISNRLVLTAA 116
            |..|.|:|.      .::.|:.:.|..:|:.    :||||.:        |||:||....|||||
 Worm    48 PADYVTLDH------RLIGGSESSPHSWPWTVQLLSRLGHHR--------CGGSLIDPNFVLTAA 98

  Fly   117 HCFFSEHGEVNV-VRLGELEFDTDTDDAEPEDFGVLALKAHP----GFENPQLYNDIGIVQLDRE 176
            |||..:....:. ||:|    ...:....|.  .|.|:..||    ||  |..| |..|:::...
 Worm    99 HCFAKDRRPTSYSVRVG----GHRSGSGSPH--RVTAVSIHPWYNIGF--PSSY-DFAIMRIHPP 154

  Fly   177 VKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPN 241
            |..:....|.|||.....::...:..|||    :..|...|....|:......:|::..: .|||
 Worm   155 VNTSTTARPICLPSLPAVENRLCVVTGWG----STIEGSSLSAPTLREIHVPLLSTLFCS-SLPN 214

  Fly   242 GYEPK----SQLCIGSRDNK-DTCNGDSGGPVLAYHKDLACM----YHVMGITSAGITCSTPDIP 297
             |..:    |.||.|....| |:|.||||||       |.|.    :.:.|:.|.||.|:.|.:|
 Worm   215 -YIGRIHLPSMLCAGYSYGKIDSCQGDSGGP-------LMCARDGHWELTGVVSWGIGCARPGMP 271

  Fly   298 SAYTRVHYFLNWIKGEL 314
            ..|..||....||..|:
 Worm   272 GVYGNVHSASTWINLEM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 76/256 (30%)
Tryp_SPc 72..310 CDD:214473 75/255 (29%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 76/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.