DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG43336

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:291 Identity:87/291 - (29%)
Similarity:139/291 - (47%) Gaps:51/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VAISFFFTDAPITYETVDSCHGSR------PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGG 104
            |.::||......:.:.:|...|.|      |.:.:||.|.....|:.|.| |   :.:.::.|||
  Fly     6 VGLTFFLLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFL-H---STDGRFICGG 66

  Fly   105 TLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKA--HPGFE----NPQ 163
            :||:|||||||||||. :..|: |.|||  |:|.:..:...:.:....::|  ..||.    ||.
  Fly    67 SLITNRLVLTAAHCFL-DRTEL-VARLG--EYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPM 127

  Fly   164 -LYNDIGIVQLDREVKFNRYKHPACLPFDDG-----EQHESFIAIGWGQKKFAQKESKKLLKVQL 222
             :..||.|::|.|:|::.....|.|:..|..     :..:.....||| |..::.:|.||..|.|
  Fly   128 TMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWG-KTESEGDSAKLRTVDL 191

  Fly   223 -QGYKDRC----VSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPV---LAYHKDLACMY 279
             :.:.:.|    ..|:.||           |.|.|: :..:.|||||||||   :.|.|  :..:
  Fly   192 ARKHPEVCRRYATLSLTAN-----------QFCAGN-ERSNLCNGDSGGPVGALIPYGK--SKRF 242

  Fly   280 HVMGITSAGITCSTPDIPSAYTRVHYFLNWI 310
            ..:||  |..|.:...:.|.:|.|..:::||
  Fly   243 VQVGI--ASFTNTQCVMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 80/259 (31%)
Tryp_SPc 72..310 CDD:214473 78/257 (30%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 78/258 (30%)
Tryp_SPc 40..271 CDD:238113 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.