DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG43110

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:253 Identity:79/253 - (31%)
Similarity:117/253 - (46%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGEL 134
            |.|:.|:.|..:...:.|.:     .|.....||||:|....|||.|||   :..:...||||..
  Fly    34 PKIISGSNASQQSAQYMAGI-----FNTTHLLCGGTIIHEDFVLTVAHC---KSTQTLFVRLGAY 90

  Fly   135 EFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDD--GEQHE 197
            ..:..||...     |:...|||.:.|....|||.:|:|:|.|.||....|.|:..|.  |:|..
  Fly    91 NINHPTDQIR-----VIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIR 150

  Fly   198 SFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGY-----EPKSQLCIGSRDNK 257
            .:.|.|||:.:.|: :|..|.::    :.:|      .|..:.:.|     :|| |:| .:.|..
  Fly   151 YYNAFGWGRTRNAE-QSDILQRI----FVNR------TNPMICHLYLGMSPDPK-QIC-ATTDQG 202

  Fly   258 DTCNGDSGGPVLA---YH-KDLACMYHVMGITSAGI-TCSTPDIPSAYTRVHYFLNWI 310
            |||.||||||:::   |. |:....:   ||||.|. .|:...:   ||.|..:..||
  Fly   203 DTCAGDSGGPLISKITYQGKNFDTQF---GITSYGTRECNGVGL---YTDVSQYSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 78/251 (31%)
Tryp_SPc 72..310 CDD:214473 76/249 (31%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 76/250 (30%)
Tryp_SPc 36..257 CDD:238113 78/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.