DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG43124

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:104 Identity:31/104 - (29%)
Similarity:44/104 - (42%) Gaps:29/104 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFE 160
            ::.|..|.|.||:|..|||||.||  :..|...||||...||                |::..|.
  Fly    48 SDSKVICAGALINNLYVLTAASCF--KENEKLTVRLGSGYFD----------------KSYENFR 94

  Fly   161 NPQLY-----------NDIGIVQLDREVKFNRYKHPACL 188
            ..:.|           |::.|.:|..||:|..:..|.|:
  Fly    95 VTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 31/104 (30%)
Tryp_SPc 72..310 CDD:214473 31/104 (30%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 30/102 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.