DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG43125

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:210 Identity:49/210 - (23%)
Similarity:91/210 - (43%) Gaps:23/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 CGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFD-TDTDDAEPEDFGVLALKAHPGFENPQLY 165
            |.||||:.|.|||||.|.  ::....:|||||::.. .::...:.|:..|.....|..:.:....
  Fly    52 CTGTLINERFVLTAASCI--DYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQ 114

  Fly   166 NDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCV 230
            .:|.:::|...|.:.:...|.|:..:.|:..:   |..:..:|...:|.||.....::.:.:..:
  Fly   115 YNIALLRLKTSVVYKKNIQPICIDVNVGKVPK---APTFEIEKKKNEEPKKNKAGIMKRFLNWFL 176

  Fly   231 SSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPD 295
            |.....:..|:...|...:.:             |.|:.....:.| ::|..||.|...:.|..|
  Fly   177 SLFGVREPRPDVILPPQPIAV-------------GWPLTKQINESA-LFHQYGILSHRNSESKKD 227

  Fly   296 IPSAYTRVHYFLNWI 310
            :   ||.|..::|||
  Fly   228 V---YTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 49/210 (23%)
Tryp_SPc 72..310 CDD:214473 47/208 (23%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.