DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and CG42694

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:270 Identity:66/270 - (24%)
Similarity:111/270 - (41%) Gaps:46/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TVDSCHGSRPLIVD--GTPAEPKEF-----PFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHC 118
            ||...|.:...:.|  |.|...:..     |.|..|.|......:  .|.|:|||.:.||:||.|
  Fly    12 TVLQSHVNSKFLDDYCGAPISNQSITKLRQPQAGWLAHISNGTHV--LCSGSLISKQFVLSAAQC 74

  Fly   119 FFSEHGEVNVVRLGELEFDTDTDDAEPEDFGV--LALKAHPGFENPQLYNDIGIVQLDREVKFNR 181
             ...||:: .|:||     .......|..:.|  :.:.:|.|   .:|..|||:::|.:.|.:|.
  Fly    75 -IDVHGKL-FVQLG-----VSNATKSPHWYTVSNVVIPSHSG---KRLQRDIGLLKLSQSVDYND 129

  Fly   182 YKHPACLPFDDGEQH-----ESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPN 241
            :.:|.|:..:.....     ::|....|..|   .|..:.::..||.  :|||..::..|     
  Fly   130 FVYPICIALNTNTLDMVKILQNFTTSAWLSK---NKNPQTIVLSQLS--RDRCKLNLSGN----- 184

  Fly   242 GYEPKSQLCIGSRDNKDTCNGDSGG----PVLAYHKDL-ACMYHVMGITSAGITCSTPDIPSAYT 301
             ..|| ::|..|....::|..|||.    |::.....: ..::.:.|..:....||.|.|   |.
  Fly   185 -VTPK-EICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSEPAI---YI 244

  Fly   302 RVHYFLNWIK 311
            .|...:.||:
  Fly   245 DVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/257 (24%)
Tryp_SPc 72..310 CDD:214473 61/256 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 58/236 (25%)
Tryp_SPc 46..253 CDD:214473 56/233 (24%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437618
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.