DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and prss27.3 (prov)

DIOPT Version :10

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_002939724.1 Gene:prss27.3 (prov) / 100491461 XenbaseID:XB-GENE-5892934 Length:267 Species:Xenopus tropicalis


Alignment Length:227 Identity:69/227 - (30%)
Similarity:102/227 - (44%) Gaps:30/227 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQ 163
            |::|||:|||:.|||||||||........||.||..:...:..:..|..  |..:..||.:....
 Frog    49 KYYCGGSLISSNLVLTAAHCFEVLDASSVVVILGAYKITGNPKEEIPVQ--VKQIIIHPSYNESD 111

  Fly   164 LYNDIGIVQLDREVKFNRYKHPACLP-----FDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQ 223
            ...||.::||.:.|.|.||..|..||     |..|   :|.:..|||   :.:....|...|.||
 Frog   112 NSADIALLQLSQNVPFTRYILPVLLPTTSTVFLPG---QSCVVTGWG---YLELNKTKPKPVNLQ 170

  Fly   224 GYKDRCVSSVDANDELPNGYEPK--------SQLC-IGSRDNKDTCNGDSGGPVLAYHKDLACMY 279
            ..:.|.:|:    ::....||.|        ..:| :........|.||||||::.|.   ....
 Frog   171 EAEVRLMSA----EQCRGYYESKGVGPLVGAGMICAVDILGRSGPCLGDSGGPLVCYK---GGQQ 228

  Fly   280 HVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311
            .::|:.:....|. .:.|:.||.|..:|:|||
 Frog   229 FLVGVVTFASGCG-GEPPAVYTSVSAYLDWIK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 67/225 (30%)
prss27.3 (prov)XP_002939724.1 Tryp_SPc 28..260 CDD:238113 69/227 (30%)

Return to query results.
Submit another query.