DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and gzma

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:252 Identity:76/252 - (30%)
Similarity:110/252 - (43%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEF 136
            |:||..|.....|:.|.: :.:|.:     ||||||....|||||||..:.    :.|.||  ..
 Frog    35 IIDGREAASHSRPYMAYI-YSRTGS-----CGGTLIKQNWVLTAAHCVVNN----SEVILG--AH 87

  Fly   137 DTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGE--QHESF 199
            ...:.:.|.:.|.|.....||.||..:..:||.::|:....|.|::.....||..|.:  ...|.
 Frog    88 KVKSRENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDMDVKPGSSC 152

  Fly   200 IAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDAN--DELPNGYEPK---SQLCIGS---RDN 256
            ...|||..|...|....:|       ::..|:.||..  :::...::.:   :.||.|:   .|.
 Frog   153 STAGWGVTKPNGKTPSDVL-------REVNVTVVDRGTCNKIYKKFKTEISTNMLCAGAPKKSDK 210

  Fly   257 K-DTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRV-HYFLNWIK 311
            | |.|.||||||       |.|.....||.|.|..|..|..|..|||: ..:|.||:
 Frog   211 KYDACQGDSGGP-------LICGKEFSGIVSFGKKCGDPKYPGIYTRLTARYLQWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 75/250 (30%)
Tryp_SPc 72..310 CDD:214473 74/249 (30%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.