DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11841 and si:dkey-78l4.13

DIOPT Version :9

Sequence 1:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 / 100034660 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio


Alignment Length:246 Identity:78/246 - (31%)
Similarity:114/246 - (46%) Gaps:34/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEF 136
            ||:|..|.|...|:...:...:     |..|||.|:|.:.|:||||||.  :|:...|.:|..|:
Zfish    25 IVNGNEARPHSRPYMVSVQCNR-----KHICGGFLVSEQFVMTAAHCFV--NGKELTVVVGAHEY 82

  Fly   137 DTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGE---QHES 198
               ||.|...|  |.....|||||:..|.|||.::||.::||.:...:...:|..|.:   :.:.
Zfish    83 ---TDGASRMD--VKFYHIHPGFESKTLLNDIMLLQLHKKVKKSNKVNWIPIPNADKDIKAKTKC 142

  Fly   199 FIAIGWGQKKFAQKESKKLLKVQLQGY-KDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNG 262
            .:| |||:.....:.|.||::|.:..: |..|.......      |.....:|.|....  .|.|
Zfish   143 SVA-GWGKNTTHGEVSAKLMEVNVTLFDKKACQKYWGPT------YSTSKMMCTGGHGG--FCQG 198

  Fly   263 DSGGPVLAYHKDLACMYHVMGITSAG--ITCSTPDIPSAYTRVHYFLNWIK 311
            |||||       |.|....:||.|..  ..|.:|..|:.||::..||:|||
Zfish   199 DSGGP-------LVCDKVAVGIVSFNEKNNCDSPTKPNVYTQISKFLSWIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 76/244 (31%)
Tryp_SPc 72..310 CDD:214473 75/243 (31%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.