DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and MTF1

DIOPT Version :9

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_013955.1 Gene:MTF1 / 855268 SGDID:S000004841 Length:341 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:66/333 - (19%)
Similarity:117/333 - (35%) Gaps:93/333 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FGQHILKNPLVITTMLEKAALRATD------VVLEIGPGTGNMTVRMLER--AKKVIACEIDTRL 83
            :|...|.||.|...:.:|..|..|.      .||::.||.|..:.....:  .::....|..:.|
Yeast    18 YGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSL 82

  Fly    84 AAELQKRVQATPLQ-----------------------PKLQVLIGDFLKAELPFFDLCIANVPYQ 125
            ...|..:.:.:|||                       |::|  ..|.:..:.    |.:|||..:
Yeast    83 YKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQ--SSDHINDKF----LTVANVTGE 141

  Fly   126 ISSPLIFKLLL----HRPLFRCA----VLMFQREFAERLVAKPGDKLYCRLSI------NTQLLA 176
            .|..||.:.|.    ...|:|..    :|......|.:|:|:||.....:.|:      :|:|:|
Yeast   142 GSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIA 206

  Fly   177 RVDMLMKVGKNN-----FRPPPKVESSVVRLEPKNPPP-------PVNF----TEWDGLTRIAFL 225
            ..|.....|.::     :.|   :..|...:.|....|       |::|    ..||.:||...:
Yeast   207 ISDANELKGFDSQCIEEWDP---ILFSAAEIWPTKGKPIALVEMDPIDFDFDVDNWDYVTRHLMI 268

  Fly   226 RKNKTLAATFKVTSVLEMLEKNYKLYRSLRNEPIEDDFKMQDKVISILEEQDMAAKRARSMDIDD 290
            .|...|      .:|::.|....:.|.:.|                 :.::|:..|....:..|:
Yeast   269 LKRTPL------NTVMDSLGHGGQQYFNSR-----------------ITDKDLLKKCPIDLTNDE 310

  Fly   291 FMRLLLAF 298
            |:.|...|
Yeast   311 FIYLTKLF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 66/333 (20%)
MTF1NP_013955.1 RrnaAD 11..316 CDD:395321 65/329 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11727
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.