DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and PFC1

DIOPT Version :9

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001322240.1 Gene:PFC1 / 839283 AraportID:AT1G01860 Length:346 Species:Arabidopsis thaliana


Alignment Length:274 Identity:74/274 - (27%)
Similarity:124/274 - (45%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KDFGQHILKNPLVITTMLEKAALRATDVVLEIGPGTGNMTVRMLERAKKVIACEIDTRLAAELQK 89
            |..|||.:.|..:...:...|.::..|.|||||||||::|..::.....|:|.|.|..:...:.:
plant    73 KSLGQHYMLNSDINDQLASAADVKEGDFVLEIGPGTGSLTNVLINLGATVLAIEKDPHMVDLVSE 137

  Fly    90 RVQATPLQPKLQVLIGDFLKAELPFFDLCI-----------------ANVPYQISSPLIFKLLLH 137
            |...:   .|.:||..||:|..:....|.|                 :|:|:.||:.::..||..
plant   138 RFAGS---DKFKVLQEDFVKCHIRSHMLSILETRRLSHPDSALAKVVSNLPFNISTDVVKLLLPM 199

  Fly   138 RPLFRCAVLMFQREFAERLVAKPGDKL--YCRLSINTQLLARVDMLMKVGKNNFRPPPKVESSVV 200
            ..:|...||:.|.|.|.||| :|..:.  |..::|.....:..:...:|.:.||.|.|||:::||
plant   200 GDIFSKVVLLLQDEAALRLV-EPALRTSEYRPINILINFYSEPEYNFRVPRENFFPQPKVDAAVV 263

  Fly   201 RLEPKNPP--PPVNFTE-WDGLTRIAFLRKNKTLAATFKVTSVLEMLEK--------------NY 248
            ..:.|:|.  |.|:.|: :..|...||..|.|.|..:.:..|....:||              ::
plant   264 TFKLKHPRDYPDVSSTKNFFSLVNSAFNGKRKMLRKSLQHISSSPDIEKALGVAGLPATVSNLSH 328

  Fly   249 KLYRSLRNEPIEDD 262
            .||..|.:..:.::
plant   329 VLYEVLGSSSLHEN 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 74/274 (27%)
PFC1NP_001322240.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100569
Panther 1 1.100 - - O PTHR11727
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.