DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and tfb1m

DIOPT Version :9

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_021322908.1 Gene:tfb1m / 767802 ZFINID:ZDB-GENE-060929-1010 Length:354 Species:Danio rerio


Alignment Length:260 Identity:70/260 - (26%)
Similarity:110/260 - (42%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VFNKDFGQHILKNPLVITTMLEKAALRATDV----VLEIGPGTGNMTVRMLER-AKKVIACEIDT 81
            ::|....:.:.:|.|:.|.:.:|...:|.::    |.|:|||.|.:|..:|:. |..::..|.|.
Zfish    29 LYNLKAQKQLSQNFLLDTRLTDKIVRQAGNLNNAHVCEVGPGPGGLTRSILKAGAADLLVVEKDM 93

  Fly    82 RLAAELQKRVQATPLQPKLQVLIGDFLKAEL----------------PFFDLCIANVPYQISSPL 130
            |....||...:|.|  .::::..||.|..:|                |...: |.|:|:.:|:||
Zfish    94 RFIPGLQLLSEAAP--GRIRIAQGDILAYKLERRFPANITKTWEDDPPNLHI-IGNLPFNVSTPL 155

  Fly   131 IFKLLLHRPLFRCAVLM---------FQREFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGK 186
            |.| .|.:...|..:.|         ||:|.||||.|..|.:...|||:..|.|..|.....:..
Zfish   156 IIK-WLEQMSNRTGIFMFGRTRLTLTFQKEVAERLTASTGSRQRSRLSVMAQYLTTVKSCFTIPG 219

  Fly   187 NNFRPPPKVESSVVRLEPKNPP---PPVNFTEWDGLTRIAFLRKN--KTLAATFKVTSVLEMLEK 246
            ..|.|.|.|:..||...|...|   .|....|........|.||:  :.|...|..:...|:.|:
Zfish   220 QAFVPKPNVDVGVVHFTPLAQPQIQQPFKLVEKIVKNAFQFRRKHCRRGLGMLFPESQRQELTEE 284

  Fly   247  246
            Zfish   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 70/260 (27%)
tfb1mXP_021322908.1 ksgA 20..315 CDD:234708 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.