DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and TFB2M

DIOPT Version :9

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_071761.1 Gene:TFB2M / 64216 HGNCID:18559 Length:396 Species:Homo sapiens


Alignment Length:315 Identity:76/315 - (24%)
Similarity:117/315 - (37%) Gaps:105/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DFGQHILKNPLVIT---TMLEKAALRATDVVLEIGPGTGNMTVRMLERAKKVIACEIDTRLAAEL 87
            ||.:::....|..|   ..|.|.: |...::||..||.|.:|..:||...||:|.|.|......|
Human    70 DFKRYVTDRRLAETLAQIYLGKPS-RPPHLLLECNPGPGILTQALLEAGAKVVALESDKTFIPHL 133

  Fly    88 QKRVQATPLQPKLQVLIGDFLKAELP----------------FFDLCIANVPYQISSPL------ 130
            :.  ....|..||:|:..||.|.: |                |.:|.|..||:....||      
Human   134 ES--LGKNLDGKLRVIHCDFFKLD-PRSGGVIKPPAMSSRGLFKNLGIEAVPWTADIPLKVVGMF 195

  Fly   131 --------IFKLLLHRPLFRCA---------VLMF--QREFAERLVAKPGD-KLYCRLSINTQLL 175
                    ::||..  .|:.|.         |.||  ::|| ::|:|.||: .||..||:..||.
Human   196 PSRGEKRALWKLAY--DLYSCTSIYKFGRIEVNMFIGEKEF-QKLMADPGNPDLYHVLSVIWQLA 257

  Fly   176 ARVDMLMKVGKNNFRPPPKVESSVVRLEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATFKVTSV 240
            .                   |..|:.:||        ::.:|..||...|...|.       ..:
Human   258 C-------------------EIKVLHMEP--------WSSFDIYTRKGPLENPKR-------REL 288

  Fly   241 LEMLEKNYKLYRSLRNEPIEDDFKMQDKVISILEEQDMAAKRARSMDIDDFMRLL 295
            |:.|::  |||                 :|.::..|::..|....|:.:.|..||
Human   289 LDQLQQ--KLY-----------------LIQMIPRQNLFTKNLTPMNYNIFFHLL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 76/315 (24%)
TFB2MNP_071761.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..64
AdoMet_MTases 94..379 CDD:302624 70/290 (24%)
DNA binding. /evidence=ECO:0000269|PubMed:29149603, ECO:0007744|PDB:6ERP, ECO:0007744|PDB:6ERQ 330..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.