DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and tfb2m

DIOPT Version :9

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001107089.2 Gene:tfb2m / 569468 ZFINID:ZDB-GENE-070521-3 Length:437 Species:Danio rerio


Alignment Length:331 Identity:73/331 - (22%)
Similarity:132/331 - (39%) Gaps:70/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DVQKQGIVFNKDFGQHILKNPL--VITTMLEKAALRATDVVLEIGPGTGNMTVRMLER-AKKVIA 76
            |..:|..:..|:..:.|:...|  ::|..|.:.......|:.|..||.|.:|..:|.| |::|:|
Zfish    97 DENEQKALVCKNLRRFIVDPALATIVTDHLSRDIDDGKAVIFECNPGPGVLTRALLNRGAQRVVA 161

  Fly    77 CEIDTRLAAELQKRVQATPLQPKLQVLIGDFLK---------------AELPFFDLCIANVPYQI 126
            .|.|.....||.:  ..:.|:.:|.|:..||.|               :|..|.||.|:.||:..
Zfish   162 LESDANFLPELLE--LESRLEGQLDVVHCDFFKLDPIGNGIMKPPVMYSEKLFSDLAISEVPWTA 224

  Fly   127 SSP------------------LIFKLLLHRPLF---RCAVLMF--QREFAERLVAKPGD-KLYCR 167
            ..|                  :|:.|...|.:|   |..::||  |:|:. :||.:|.| |.|..
Zfish   225 DVPVKIVGLFTQRNERNLMWKMIYNLFERRSIFRYGRVELIMFISQKEYT-KLVTRPRDYKNYQA 288

  Fly   168 LSINTQLLARVDMLMK-------VGKNNFRPPPKVES-------SVVRLEPKNPPPPVNFTEWDG 218
            .|...|:...:::|.:       ...||.|......:       .:||:.|:......:.|..:|
Zfish   289 FSALAQMAFDIELLHEEPLSSFLTTTNNNRKSASGSTLSQSENLCLVRITPREDLFSSHLTPLNG 353

  Fly   219 LTRIAFL------RKNKTLAA--TFKVTSVLEMLEKNYKLYRSLRNEPIEDDFKMQDKVISILEE 275
            .|.:..:      ||.|.:..  ::......|::.....|..:|..:...|::|   ::..::|:
Zfish   354 STLVLMVKQCLAKRKGKLIQQINSWSPGMGSELISNLGFLDDTLTGDVYPDEYK---RLFELMEQ 415

  Fly   276 QDMAAK 281
            ....|:
Zfish   416 SGSFAE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 72/330 (22%)
tfb2mNP_001107089.2 P-loop_NTPase 41..>113 CDD:304359 3/15 (20%)
AdoMet_MTases 112..415 CDD:302624 68/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.