DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and mtTFB2

DIOPT Version :9

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649971.1 Gene:mtTFB2 / 41228 FlyBaseID:FBgn0037778 Length:452 Species:Drosophila melanogaster


Alignment Length:311 Identity:61/311 - (19%)
Similarity:121/311 - (38%) Gaps:75/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRIHNDVQKQGIV-FNKDFGQHILKNPLVITTML----EKAALR------------ATDVVLEIG 57
            :|.:...:|:.:. ::.||.:.:|.....:.|.:    .:||.|            ..|.|:|:.
  Fly    11 ARANYSTKKELVTRYSGDFPEKLLNRKQKVPTHMYIANSEAAARINQYLEPHFQSSGCDTVMELN 75

  Fly    58 PGTGNMTVRMLERA---KKVIACEIDTRLAAELQKRVQATPLQPKLQVLIGDFLKA-ELPFFDL- 117
            .|.|..|..:|:|.   :::|..|.......::|:.....|  .:::|..|||:.. :|.:.|. 
  Fly    76 SGAGYFTRHLLDRESQFRRIILLESMDHFMPKIQELHTLYP--ERVKVRQGDFVNLWKLVYMDKM 138

  Fly   118 --------CIANVPYQ-------------ISSPLIFKLLLHRPLFRCAVLMFQREFAERLVAKP- 160
                    .:::||.:             :.|...||.|::..:|:.::....|  .|.::|.| 
  Fly   139 DGGSRVADLLSDVPQKAFTDDINMLVFGAVGSYPFFKHLINSLIFQTSLFNLGR--CEMILAMPP 201

  Fly   161 ------------GDKLYCRLSINTQLLARVDMLMKVGKNNFRP-----PPKVESSVVRLEPKNPP 208
                        |..:|...|:..|:|.....:.||.:.:|.|     .|...|.:.:::..|| 
  Fly   202 PIYIHLTCNNEIGYLIYRSTSVLFQILFEHKFIAKVPREDFLPQQMAYSPTKSSKLGKVQSINP- 265

  Fly   209 PPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKLYRSLRNEPI 259
                  |:..|.:....|....|..:..:.::...:::||.   |.||..|
  Fly   266 ------EYLYLVKFTPRRNLHELCQSQDLPALWFFIKQNYV---SRRNRII 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 60/305 (20%)
mtTFB2NP_649971.1 AdoMet_MTases 69..309 CDD:302624 52/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11727
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.