DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and DIMT1

DIOPT Version :9

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_055288.1 Gene:DIMT1 / 27292 HGNCID:30217 Length:313 Species:Homo sapiens


Alignment Length:313 Identity:211/313 - (67%)
Similarity:253/313 - (80%) Gaps:7/313 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKVTKEKKSRIHNDVQKQ-------GIVFNKDFGQHILKNPLVITTMLEKAALRATDVVLEIGP 58
            ||||......|.....:::       |::||...|||||||||:|.::::|||||.||||||:||
Human     1 MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGP 65

  Fly    59 GTGNMTVRMLERAKKVIACEIDTRLAAELQKRVQATPLQPKLQVLIGDFLKAELPFFDLCIANVP 123
            |||||||::||:||||:|||:|.||.|||.||||.||:..|||||:||.||.:|||||.|:||:|
Human    66 GTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLP 130

  Fly   124 YQISSPLIFKLLLHRPLFRCAVLMFQREFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNN 188
            ||||||.:||||||||.||||:||||||||.|||||||||||||||||||||||||.||||||||
Human   131 YQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNN 195

  Fly   189 FRPPPKVESSVVRLEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKLYRS 253
            |||||||||||||:||||||||:||.|||||.||.|:||||||:|.||.::|.::|||||:::.|
Human   196 FRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCS 260

  Fly   254 LRNEPIEDDFKMQDKVISILEEQDMAAKRARSMDIDDFMRLLLAFNSAGIHFN 306
            :.|..|.:||.:.||:..||.....:.|||||||||||:|||..||:.||||:
Human   261 VHNIIIPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 204/295 (69%)
DIMT1NP_055288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 5/19 (26%)
PTZ00338 24..312 CDD:240367 204/287 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157905
Domainoid 1 1.000 370 1.000 Domainoid score I908
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7047
Inparanoid 1 1.050 432 1.000 Inparanoid score I1717
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53890
OrthoDB 1 1.010 - - D240437at33208
OrthoFinder 1 1.000 - - FOG0002924
OrthoInspector 1 1.000 - - oto90806
orthoMCL 1 0.900 - - OOG6_100569
Panther 1 1.100 - - LDO PTHR11727
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R317
SonicParanoid 1 1.000 - - X3272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.