DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11837 and tfbm-1

DIOPT Version :9

Sequence 1:NP_651660.1 Gene:CG11837 / 43429 FlyBaseID:FBgn0039627 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_491242.2 Gene:tfbm-1 / 188022 WormBaseID:WBGene00020189 Length:367 Species:Caenorhabditis elegans


Alignment Length:312 Identity:84/312 - (26%)
Similarity:128/312 - (41%) Gaps:54/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KDFGQHILKNPLVITTMLEKAALRATDVVLEIGPGTGNMTVRMLER-AKKVIACEIDTRLAAELQ 88
            |...|:.|.:..:...:.:.|.:...|.|:|||||.|.:|..:||. |.::...|||.|....||
 Worm    26 KILSQNYLMDMNITRKIAKHAKVIEKDWVIEIGPGPGGITRAILEAGASRLDVVEIDNRFIPPLQ 90

  Fly    89 KRVQATPL------QPKLQVLIGDFLKAE-------------LPFFDLCIANVPYQISSPLIFKL 134
            ...:|...      |..|:..|||..|.|             ||...: |.|:|:.|:||||.|.
 Worm    91 HLAEAADSRMFIHHQDALRTEIGDIWKNETARPESVDWHDSNLPAMHV-IGNLPFNIASPLIIKY 154

  Fly   135 LLHRPL-FRCAV---------LMFQREFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNNF 189
            |  |.: :|..|         |.||.|.|:||.:........|:||.:|.:|...|:.::..:.|
 Worm   155 L--RDMSYRRGVWQYGRVPLTLTFQLEVAKRLCSPIACDTRSRISIMSQYVAEPKMVFQISGSCF 217

  Fly   190 RPPPKVESSVVRLEP-KNPPPPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKLYRS 253
            .|.|:|:..|||..| |.|....:|...:.:.|..|..:.|.:....|.            ||..
 Worm   218 VPRPQVDVGVVRFVPRKTPLVNTSFEVLEKVCRQVFHYRQKYVTKGLKT------------LYPE 270

  Fly   254 LRNEPIEDDFKMQDKVISILEEQDMAAKRARSMDIDDFMRLLLAFNSAGIHF 305
            ...:.:.||...:.::       |......| :.|:.|..|...:|...|.:
 Worm   271 ELEDELSDDLLKKCRI-------DPTTTSIR-LGIEQFADLAEGYNEQCIRY 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11837NP_651660.1 PTZ00338 16..305 CDD:240367 84/310 (27%)
tfbm-1NP_491242.2 ksgA 10..305 CDD:234708 82/301 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.