DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and YPK2

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_013822.1 Gene:YPK2 / 855130 SGDID:S000004710 Length:677 Species:Saccharomyces cerevisiae


Alignment Length:344 Identity:148/344 - (43%)
Similarity:217/344 - (63%) Gaps:6/344 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GSGGVGATGETRPGK---CSLLDFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDD 449
            |.|.:..|.:.:|.|   .|:.||:.:||:|||||||||...||.|.:|||:|.|:|..|:...:
Yeast   321 GYGKLNITVDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCE 385

  Fly   450 VDCTMTEKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAA 514
            |..|:.|:.:|| ..:.||:..|...||:|::|:.|:.::|||:|.:.:|...||..:|:.||.|
Yeast   386 VTHTLAERTVLA-RVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIA 449

  Fly   515 EVTLALQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEIL 579
            |:..||..||...|||||||.:|||||.:||..|.|||:||..:.:...|.||||||:|:|||||
Yeast   450 ELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEIL 514

  Fly   580 KEQEYGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTK 644
            ..|.|..:||||.||:|:||||.|.||:..:|...::..|:...:|:|......|..:|.|.|::
Yeast   515 LGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSR 579

  Fly   645 NPEQRLGCTGDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPI 709
            :|.:|||..|.: |||.||||..:.||:|..:...||::|.:|:..|..|||.|||||.|: ..:
Yeast   580 DPSRRLGVNGTD-EIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPI-DSV 642

  Fly   710 GNEVVRCINQDEFAGFSFV 728
            .:|.:....|.:|.|::::
Yeast   643 VDEYLSASIQKQFGGWTYI 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 140/317 (44%)
YPK2NP_013822.1 YPK1_N_like 114..339 CDD:212165 5/17 (29%)
PKc_like 349..660 CDD:419665 139/313 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.