DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and AT5G40030

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_198819.1 Gene:AT5G40030 / 834000 AraportID:AT5G40030 Length:499 Species:Arabidopsis thaliana


Alignment Length:507 Identity:130/507 - (25%)
Similarity:210/507 - (41%) Gaps:136/507 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 KQQPRRSKYLNQQGGEDNYGASLGADGDGAPGQSFRSCALSVDSLATSTTTMTSGYNSSSCMSLA 385
            ||.|.....  |.....||..:..:...|       |.:....|..:....:.:..:.|.|.|.:
plant     3 KQTPNLESL--QDCSSSNYNNANASPVSG-------SASFKTSSNGSEDVRLNNSISLSFCSSNS 58

  Fly   386 VTGSGGVGAT--------------GETRPG-------------KCS------LLDFNFIKVLGKG 417
            |:....:..|              ..::|.             |||      |..|..:|.||.|
plant    59 VSSEANLEKTQSFDANEANFKRVFAPSKPHKGNDLRWDAIQNVKCSKNEDLGLGHFRLLKKLGCG 123

  Fly   418 SFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTALHSCFQTPDRL 482
            ..|.|.|||.:.....:|:||:.|..:|....:....||:.||.| .:||||..|:|.|:|....
plant   124 DIGSVYLAELREMGCFFAMKVMDKGMLIGRKKLVRAQTEREILGL-LDHPFLPTLYSHFETEKFS 187

  Fly   483 FFVMEYVNGGDL--MFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLDNILLDQEGH 545
            ..:||:.:||||  :.|.|..:.|....|.|||:||.|||::||..||:|||||.:|:::.::||
plant   188 CLLMEFCSGGDLHILRQKQPGKHFSELAARFYASEVLLALEYLHMMGVVYRDLKPENVMVREDGH 252

  Fly   546 CKLADFGMCKEGIMNGML----------------------------------------------- 563
            ..|:||.:..:..::..|                                               
plant   253 IMLSDFDLSLQSFVSPTLIQSTSQPSCHIASYCIQPPCIDPSCKLPVACIQPSCFKPRFLNNKPR 317

  Fly   564 -----------------------TTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQP 605
                                   :.:|.||.:|:||||::...:|:|||||..|:.:||::.|:.
plant   318 KAKTEKAGSDSLPMLIAEPTAARSMSFVGTHEYLAPEIIRGDGHGSSVDWWTFGIFLYELLTGKT 382

  Fly   606 PFEADNEDELFDSIMHDDVLYPVW-LSREAVSILKGFLTKNPEQRLGCTGDENEIRKHPFFAKLD 669
            ||:.:...|...:::...:.:|.. :|..|..:::|.|||:|::|||......||::||||..::
plant   383 PFKGNGNRETLFNVVGQPLKFPEGSISFAAKDLIRGLLTKDPKKRLGFKKGATEIKQHPFFNNVN 447

  Fly   670 WKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPIGNEVVRCINQDE 721
            |..:  |:..||..||                  |:...|.||.::...|.:
plant   448 WALI--RSTTPPEIPK------------------PIDLSILNETLKSSVQQQ 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 110/383 (29%)
AT5G40030NP_198819.1 STKc_phototropin_like 113..464 CDD:270726 107/371 (29%)
Keratin_B2_2 276..>309 CDD:372783 0/32 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.