DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and AT3G44610

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_190047.2 Gene:AT3G44610 / 823587 AraportID:AT3G44610 Length:451 Species:Arabidopsis thaliana


Alignment Length:420 Identity:112/420 - (26%)
Similarity:180/420 - (42%) Gaps:97/420 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 ALSVDSLATSTTTMTSGYNSSSCMSLAVT---GSGGVGATGETRP---GKCSLLDFNFIKVLGKG 417
            ::|..|..|:....||..:.||..:.|:|   .:.|..::.:..|   ...||.|..|...||.|
plant    14 SVSFTSAGTTVNRSTSSGSRSSSSAAALTPAPSAHGSFSSSKLPPSLRSSLSLSDLRFRLRLGSG 78

  Fly   418 SFGKVMLAEKKGTDEI----------YAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTAL 472
            ..|.|.|||.|....:          .|.||:.|..:..........||:.||. :.:||||..|
plant    79 DIGSVFLAEFKSLTAVTETTAVKLPLLAAKVMDKKELASRSKEGRAKTEREILE-SLDHPFLPTL 142

  Fly   473 HSCFQTPDRLFFVMEYVNGGDL--MFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKL 535
            ::...:|..|..:.|:..||||  :.|.|..:||..|...||.:||.:|:::||..|::|||||.
plant   143 YAAIDSPKWLCLLTEFCPGGDLHVLRQKQTHKRFHESAVRFYVSEVIVAIEYLHMLGIVYRDLKP 207

  Fly   536 DNILLDQEGHCKLADFGM---CKE------------GIMNG------------------------ 561
            :|:|:..:||..|.||.:   |.|            .:.||                        
plant   208 ENVLVRSDGHIMLTDFDLSLKCDESTSTPQIVLNRNNLPNGSSDQNENQGMDHRQTTSSSCMIPN 272

  Fly   562 -----------------------------------MLTTTFCGTPDYIAPEILKEQEYGASVDWW 591
                                               :.:.:|.||.:|:||||:..:.:|::||||
plant   273 CIVPAVSCFHPRIRRRKKKTDHRNNGPELVAEPVDVRSMSFVGTHEYLAPEIVSGEGHGSAVDWW 337

  Fly   592 ALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYP--VWLSREAVSILKGFLTKNPEQRLGCTG 654
            .||:.|:|:..|..||:..:.:....:|:...:.:|  ..:...|..::...|.|:|.:|||.:.
plant   338 TLGIFMFELFYGTTPFKGMDHELTLANIVARALEFPKEPTIPSAAKDLISQLLAKDPSRRLGSSL 402

  Fly   655 DENEIRKHPFFAKLDWKELEKRNIKPPFRP 684
            ....:::||||..::|..|  ...:|||.|
plant   403 GATAVKRHPFFQGVNWALL--MCTRPPFLP 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 97/361 (27%)
AT3G44610NP_190047.2 PKc_like 71..424 CDD:304357 94/355 (26%)
S_TKc 75..413 CDD:214567 89/338 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.