DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and WAG2

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_188054.1 Gene:WAG2 / 820658 AraportID:AT3G14370 Length:480 Species:Arabidopsis thaliana


Alignment Length:408 Identity:111/408 - (27%)
Similarity:182/408 - (44%) Gaps:98/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 VDSLATSTTT------------MTSGYNSSSCMSLAVTGSGGVGATGETR--------------- 399
            :|...|||||            :|..:|.....|.|||.|....::...|               
plant    13 LDLSFTSTTTDRTFASSSARTSLTLSFNDRLSTSSAVTTSSTSSSSVNHRRHDPHWSAIKSAKLL 77

  Fly   400 --PGKCSLLDFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDDVDCTMTEKRILAL 462
              .|...|.....|:.||.|:.|:|.|...:.:...:|:||:.::.:..:..:....||..||:|
plant    78 SSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRDSSARFALKVIDRNCLTTEKKLSQVETEAEILSL 142

  Fly   463 AANHPFLTALHSCFQTPDRLFFVMEYVNGGDL--MFQIQKARRFEASRAAFYAAEVTLALQFLHT 525
             .:||||..|::..........:::|...|||  :.:.|...|.......|:||||.:||::||.
plant   143 -LDHPFLPTLYARIDESHYTCLLIDYAPNGDLHSLLRKQPGNRLPIQPVRFFAAEVLVALEYLHA 206

  Fly   526 HGVIYRDLKLDNILLDQEGHCKLADFGMC------------------------------------ 554
            .|::|||||.:|:||.::||..|:||.:|                                    
plant   207 MGIVYRDLKPENVLLREDGHVMLSDFDLCFKSDVVPTFKSRRYRRSSSSPSLRRRRSGCFSVAAE 271

  Fly   555 ----KEGIMNGML---TTTF---C-GTPDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQPPFE 608
                :|.|::...   .|.|   | ||.:|:|||::....:|:.|||||.|:.:||::.|..||:
plant   272 KKYEREEIVSEFAAEPVTAFSRSCVGTHEYLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFK 336

  Fly   609 ADNEDELFDSI----------MHDDVLYPVWLSREAVSILKGFLTKNPEQRLGCTGDENEIRKHP 663
            .:::::...:|          |..|:       .||..:::..|.|:|.:||||.....:|::||
plant   337 GESKEQTLRNIVSTTKTASFHMDGDL-------DEARDLIEKLLVKDPRKRLGCARGAQDIKRHP 394

  Fly   664 FFAKLDWKELEKRNIKPP 681
            ||..:.|..:  |:.|||
plant   395 FFDGIKWPLI--RHYKPP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 94/329 (29%)
WAG2NP_188054.1 STKc_phototropin_like 86..420 CDD:270726 95/335 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.