DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and akt3a

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001184130.1 Gene:akt3a / 560549 ZFINID:ZDB-GENE-050419-180 Length:479 Species:Danio rerio


Alignment Length:328 Identity:151/328 - (46%)
Similarity:224/328 - (68%) Gaps:8/328 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 DFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTA 471
            ||:::|:||||:||||:|..:|.:.:.||:|:|||:.||..|:|..|:||.|:|. ...|||||:
Zfish   147 DFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLK-NTRHPFLTS 210

  Fly   472 LHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLD 536
            |...|||.|||.|||||||||:|.|.:.:.|.|...|..||.||:..||.:||:..::||||||:
Zfish   211 LKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLE 275

  Fly   537 NILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMM 601
            |::||::||.|:.|||:|||||.:.....||||||:|:|||:|::.:||.:||||.|||:|||||
Zfish   276 NLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMM 340

  Fly   602 AGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQRLGCTGDE-NEIRKHPFF 665
            .|:.||...:.::||:.|:.:|:.:|..||.:|.|:|.|.|.|:|.:|||...|: .||.:|.||
Zfish   341 CGRLPFYNQDHEKLFELILMEDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFF 405

  Fly   666 AKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTP---IGNEVVRCINQD---EFAG 724
            ..:||:::..:.:.|||:|::.:..|...||.|||.:...:||   ...:.:.|::.:   .|..
Zfish   406 TGIDWQDVYDKKLIPPFKPQVSSETDTRYFDEEFTAQTITITPPEKFDEDGMDCMDNERRPHFPQ 470

  Fly   725 FSF 727
            ||:
Zfish   471 FSY 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 149/323 (46%)
akt3aNP_001184130.1 PH_PKB 4..110 CDD:269947
PH 6..105 CDD:278594
STKc_PKB_gamma 132..479 CDD:270745 151/328 (46%)
S_TKc 148..405 CDD:214567 130/257 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.