DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and Pdk1

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001261183.1 Gene:Pdk1 / 38017 FlyBaseID:FBgn0020386 Length:836 Species:Drosophila melanogaster


Alignment Length:397 Identity:110/397 - (27%)
Similarity:171/397 - (43%) Gaps:78/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 DFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTA 471
            ||.|.:.:|:||:..|.||....:...|||||.:|..|:::...|....|:.::....|.|....
  Fly   245 DFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQMTNVPGFVN 309

  Fly   472 LHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLD 536
            |...||....|:|||.|...||::..|.:...|:.:....||||:.||.:.:|...|::||||.:
  Fly   310 LSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPE 374

  Fly   537 NILLDQEGHCKLADFGMCKEGIMNG---MLTTTFC------------------------------ 568
            |||||::.|..:||||..|  :|..   .|.|..|                              
  Fly   375 NILLDEDMHTLIADFGSAK--VMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDS 437

  Fly   569 ----------------------------------GTPDYIAPEILKEQEYGASVDWWALGVLMYE 599
                                              ||..|::||:|:......:.|.||||.::|:
  Fly   438 EELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWALGCIVYQ 502

  Fly   600 MMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQRLGCT---GDENEIRK 661
            |:||.|||...|:..:|..|:...|.:|....::|..:::..|..:|..|||..   |....||.
  Fly   503 MIAGLPPFRGSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRA 567

  Fly   662 HPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKE---DPVLTPIGNEVVRCINQDEFA 723
            |||||.:||:.| ::...||..|.:.......:|.:.:|..   :|.|..  .::.|.::.:...
  Fly   568 HPFFAGIDWQTL-RQQTPPPIYPYLPGVSQDEDFRSSYTVPGDLEPGLDE--RQISRLLSAELGV 629

  Fly   724 GFSFVNP 730
            |.|...|
  Fly   630 GSSVAMP 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 106/389 (27%)
Pdk1NP_001261183.1 STKc_PDK1 244..571 CDD:270733 93/327 (28%)
S_TKc 246..571 CDD:214567 92/326 (28%)
PH_PDK1 658..764 CDD:241293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.