DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and Sgk1

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_006227785.1 Gene:Sgk1 / 29517 RGDID:3668 Length:525 Species:Rattus norvegicus


Alignment Length:331 Identity:149/331 - (45%)
Similarity:216/331 - (65%) Gaps:8/331 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 DFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTA 471
            ||:|:||:||||||||:||..|..:..||:|||:|.||::..:....|:|:.:|.....||||..
  Rat   191 DFHFLKVIGKGSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVG 255

  Fly   472 LHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLD 536
            ||..|||.|:|:||::|:|||:|.:.:|:.|.|...||.|||||:..||.:||:..::|||||.:
  Rat   256 LHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPE 320

  Fly   537 NILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMM 601
            |||||.:||..|.|||:|||.|.:...|:||||||:|:|||:|.:|.|..:||||.||.::|||:
  Rat   321 NILLDSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEML 385

  Fly   602 AGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQRLGCTGDENEIRKHPFFA 666
            .|.|||.:.|..|::|:|::..:.....::..|..:|:|.|.|:..:|||...|..||:.|.||:
  Rat   386 YGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHIFFS 450

  Fly   667 KLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPIGNE-----VVRCINQ--DEFAG 724
            .::|.:|..:.|.|||.|.:..|.|..:||.||| |:||.:.||..     |...:.:  :.|.|
  Rat   451 LINWDDLINKKITPPFNPNVSGPSDLRHFDPEFT-EEPVPSSIGRSPDSILVTASVKEAAEAFLG 514

  Fly   725 FSFVNP 730
            ||:..|
  Rat   515 FSYAPP 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 145/323 (45%)
Sgk1XP_006227785.1 S_TKc 192..449 CDD:214567 121/256 (47%)
STKc_SGK 196..518 CDD:270727 145/322 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.