DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and F48G7.10

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_503273.1 Gene:F48G7.10 / 185998 WormBaseID:WBGene00018621 Length:168 Species:Caenorhabditis elegans


Alignment Length:150 Identity:64/150 - (42%)
Similarity:90/150 - (60%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RVHQVNGHKFMATFLRQPTFCSHCREFIWGIGKQGYQCQVCTLVVHKKCHLSVVSKC---PGMRD 231
            ::|:::||:|.||.|.|||.|:.|.:.|:|:|||||:|..|..||||:||..:..:|   |. ..
 Worm    20 KIHEISGHRFKATALVQPTCCAICSKLIYGLGKQGYRCLGCETVVHKRCHSLINDRCNFGPS-SP 83

  Fly   232 EQPAKVEM----------VPAGQRFNVNLPHRFVVHSYKRFTFCDHCGSLLYGLIKQGLQCETCG 286
            .||...|:          :|:.....|:..|.|..|.|.|.|||||||||||||.|||:||..|.
 Worm    84 RQPPPQELSSDSGELRHRIPSPTEPQVSTNHHFNKHFYTRPTFCDHCGSLLYGLSKQGVQCSDCL 148

  Fly   287 MNVHKRCQKNVANTCGINTK 306
            .|||.||::...:.|.::::
 Worm   149 ANVHHRCKEKAVHNCIVSSQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556 26/53 (49%)
C1_1 252..304 CDD:278556 30/51 (59%)
STKc_nPKC_epsilon 412..729 CDD:270743
F48G7.10NP_503273.1 C1_1 27..76 CDD:278556 25/48 (52%)
C1_1 114..166 CDD:278556 30/51 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0694
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.