DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and F48G7.10

DIOPT Version :10

Sequence 1:NP_524545.2 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_503273.1 Gene:F48G7.10 / 185998 WormBaseID:WBGene00018621 Length:168 Species:Caenorhabditis elegans


Alignment Length:150 Identity:64/150 - (42%)
Similarity:90/150 - (60%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RVHQVNGHKFMATFLRQPTFCSHCREFIWGIGKQGYQCQVCTLVVHKKCHLSVVSKC---PGMRD 231
            ::|:::||:|.||.|.|||.|:.|.:.|:|:|||||:|..|..||||:||..:..:|   |. ..
 Worm    20 KIHEISGHRFKATALVQPTCCAICSKLIYGLGKQGYRCLGCETVVHKRCHSLINDRCNFGPS-SP 83

  Fly   232 EQPAKVEM----------VPAGQRFNVNLPHRFVVHSYKRFTFCDHCGSLLYGLIKQGLQCETCG 286
            .||...|:          :|:.....|:..|.|..|.|.|.|||||||||||||.|||:||..|.
 Worm    84 RQPPPQELSSDSGELRHRIPSPTEPQVSTNHHFNKHFYTRPTFCDHCGSLLYGLSKQGVQCSDCL 148

  Fly   287 MNVHKRCQKNVANTCGINTK 306
            .|||.||::...:.|.::::
 Worm   149 ANVHHRCKEKAVHNCIVSSQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_524545.2 C2_PKC_epsilon 1..134 CDD:175981
C1_nPKC_epsilon-like_rpt1 171..230 CDD:410385 29/61 (48%)
C1_nPKC_epsilon-like_rpt2 250..304 CDD:410388 30/53 (57%)
STKc_nPKC_epsilon 412..729 CDD:270743
F48G7.10NP_503273.1 C1 20..76 CDD:412127 27/55 (49%)
C1_cPKC_nPKC_rpt2 114..163 CDD:410343 29/48 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.