DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and F31E3.2

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_498522.3 Gene:F31E3.2 / 175977 WormBaseID:WBGene00017950 Length:441 Species:Caenorhabditis elegans


Alignment Length:293 Identity:100/293 - (34%)
Similarity:159/293 - (54%) Gaps:24/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 PGKCSLLDFNFI--KVLGKGSFGKVMLA------EKKGTDEIYAIKVLKKDAIIQDDDVDCTMTE 456
            |.:..:.:.:|:  :.||:||||.|..|      |:|     :|||:.:|..||....|.....|
 Worm   116 PTRSVINEKSFVLERQLGRGSFGVVYCASAIHDSERK-----FAIKMQEKREIISKRAVLQVKRE 175

  Fly   457 KRILALAANHPFLTALHSCFQTPDRLFFVMEYVNG--GDLMFQIQKARRFEASRAA--FYAAEVT 517
            ..|..|..:|||:...:|.:||...|:.:::|..|  ||| |.:.: :|...|.||  ...||:.
 Worm   176 ASIQRLLPSHPFIARTYSTWQTRTHLYSLLQYPTGSTGDL-FSVWR-QRGSLSEAAIRLIGAELA 238

  Fly   518 LALQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQ 582
            .|:.|||.:.|||||:||:|::|||.||..|.|||:.|: :..|..|.|.|||..|::|::....
 Worm   239 SAIDFLHQNDVIYRDVKLENVVLDQWGHALLIDFGLAKK-LKQGSSTGTICGTLQYMSPDVASGG 302

  Fly   583 EYGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPE 647
            .|...||||:||||::.::.|..|: .::|.....::...|...|:..|||..:::...|..:..
 Worm   303 TYSHYVDWWSLGVLLHILLTGIYPY-PNSEATHHANLKFIDYSTPIGCSREFANLMDRMLAVSIT 366

  Fly   648 QRLGCTGDENEIRKHPFFAKLDWKELEKRNIKP 680
            .|| |:  ...:..||||..:|:.:||:::..|
 Worm   367 HRL-CS--FTVLHAHPFFRSIDFSKLEQKDYTP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 98/279 (35%)
F31E3.2NP_498522.3 S_TKc 126..381 CDD:214567 93/266 (35%)
STKc_AGC 132..381 CDD:270693 92/260 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.