DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and Sgk3

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001362972.1 Gene:Sgk3 / 171498 RGDID:620242 Length:496 Species:Rattus norvegicus


Alignment Length:347 Identity:155/347 - (44%)
Similarity:216/347 - (62%) Gaps:13/347 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 VGATG--ETRPGKCSLLDFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDDVDCTM 454
            :|.||  ..:|.     ||:|:||:||||||||:||::|...:.||:|||:|..::...:....|
  Rat   149 LGPTGNPHAKPS-----DFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIM 208

  Fly   455 TEKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLA 519
            .|:.:|.....||||..||..|||.::|:||:::||||:|.|.:|:.|.|...||.|||||:..|
  Rat   209 AERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASA 273

  Fly   520 LQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEY 584
            |.:||:..::|||||.:|||||..||..|.|||:|||||.....||||||||:|:|||::::|.|
  Rat   274 LGYLHSIKIVYRDLKPENILLDSMGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPY 338

  Fly   585 GASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQR 649
            ..:||||.||.::|||:.|.|||...:..|::|:|:|..:.....:|..|.|||:..|.||.:.|
  Rat   339 DNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNR 403

  Fly   650 LGCTGDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPIGNEVV 714
            ||...|..||:.||||..|.|.:|.::.|.|||.|.:..|.|..||||.||:|....:...:...
  Rat   404 LGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDY 468

  Fly   715 RCIN------QDEFAGFSFVNP 730
            ..:|      .|.|.|||:..|
  Rat   469 SIVNASVLEADDAFVGFSYAPP 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 147/322 (46%)
Sgk3NP_001362972.1 PX_CISK 12..120 CDD:132780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157 3/7 (43%)
STKc_SGK3 165..490 CDD:270755 147/324 (45%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.