DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and Sgk3

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001032848.1 Gene:Sgk3 / 170755 MGIID:2182368 Length:496 Species:Mus musculus


Alignment Length:361 Identity:156/361 - (43%)
Similarity:221/361 - (61%) Gaps:17/361 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 YNSSSCMSLAVTGSGGVGATGETRPGKCSLLDFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLK 440
            :::|..::|..||:.....|           ||:|:||:||||||||:||::|...:.||:|||:
Mouse   141 HSTSRNINLGPTGNPHAKPT-----------DFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQ 194

  Fly   441 KDAIIQDDDVDCTMTEKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFE 505
            |..::...:....|.|:.:|.....||||..||..|||.::|:||:::||||:|.|.:|:.|.|.
Mouse   195 KKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFP 259

  Fly   506 ASRAAFYAAEVTLALQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGT 570
            ..||.|||||:..||.:||:..::|||||.:|||||..||..|.|||:|||||.....|||||||
Mouse   260 EPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDFGLCKEGIAISDTTTTFCGT 324

  Fly   571 PDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAV 635
            |:|:|||::::|.|..:||||.||.::|||:.|.|||...:..|::|:|:|..:.....:|..|.
Mouse   325 PEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAW 389

  Fly   636 SILKGFLTKNPEQRLGCTGDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFT 700
            |||:..|.||.:.|||...|..||:.||||..|.|.:|.::.|.|||.|.:..|.|..||||.||
Mouse   390 SILEELLEKNRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFT 454

  Fly   701 KEDPVLTPIGNEVVRCIN------QDEFAGFSFVNP 730
            :|....:...:.....:|      .|.|.|||:..|
Mouse   455 EETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPP 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 147/322 (46%)
Sgk3NP_001032848.1 PX_CISK 12..120 CDD:132780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157 4/15 (27%)
S_TKc 162..419 CDD:214567 124/256 (48%)
STKc_SGK3 165..490 CDD:270755 147/324 (45%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.