DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and LOC101732362

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_004918050.3 Gene:LOC101732362 / 101732362 -ID:- Length:292 Species:Xenopus tropicalis


Alignment Length:281 Identity:114/281 - (40%)
Similarity:169/281 - (60%) Gaps:19/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 EKRIL--ALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTL 518
            |||||  ..:|.||||.:|::.||:.:.|||||:|:.||||...::....||.|:|.||.|.:.|
 Frog    19 EKRILQKVTSAEHPFLVSLYATFQSENHLFFVMKYLPGGDLCHLLEHQGAFEESKAMFYTACIVL 83

  Fly   519 ALQFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQE 583
            .|:.||.:.:::|||||:|:::|..|:.|:.|||:.|:|...|..:.|.|||..|:||||:.|..
 Frog    84 GLEELHRNNIVHRDLKLENLMVDVHGYLKIVDFGLSKDGFRYGDRSKTRCGTNCYMAPEIIDEMA 148

  Fly   584 YGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQ 648
            |..:||||||||::|.|:..|.||:|:::.|||:||.:|.......||.||..::...|.|||..
 Frog   149 YSRAVDWWALGVVLYVMIMFQFPFDAEDDMELFESIRNDKPALTEELSEEAQCLILRLLEKNPCH 213

  Fly   649 RLGCT--GDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDP-----VL 706
            |||.:  |.| |::.|.||..:||:|..:|...|||:|      |.:.. .|.|::..     ::
 Frog   214 RLGSSEAGAE-EVKAHEFFEDIDWEEFLEREQMPPFKP------DVSGL-TESTRQSECQAWGLM 270

  Fly   707 TPIGNEVVRCINQDEFAGFSF 727
            .|.  |.:....|:.|.||.:
 Frog   271 PPA--EAISPEAQELFEGFDY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 114/281 (41%)
LOC101732362XP_004918050.3 PKc_like 15..292 CDD:419665 114/281 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.