DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and SGK2

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_001186193.1 Gene:SGK2 / 10110 HGNCID:13900 Length:367 Species:Homo sapiens


Alignment Length:347 Identity:146/347 - (42%)
Similarity:215/347 - (61%) Gaps:22/347 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 GVGATGETRPGKCSLLDFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDDVDCTMT 455
            |..|....:|     .||:|:||:|||::|||:||::|.....||:|||:|.:|::..:....|.
Human    23 GPSANPNAQP-----TDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMA 82

  Fly   456 EKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLAL 520
            |:.:|.....||||..|...||||::|:||::|||||:|.|.:|:.|||...||.||||||..|:
Human    83 ERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAI 147

  Fly   521 QFLHTHGVIYRDLKLDNILLDQEGHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEYG 585
            .:||:..:||||||.:|||||.:||..|.|||:||||:.....|:||||||:|:|||:|:::.|.
Human   148 GYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYD 212

  Fly   586 ASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLTKNPEQRL 650
            .:||||.||.::|||:.|.|||.:.:..:::::|:|..:..|...:..|..:|:..|.|:..|||
Human   213 RAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRL 277

  Fly   651 GCTGDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKE----------DPV 705
            |...|..||:.|.||:.::|.:|..:.:.|||.|.:..|.|..:||.|||:|          |.|
Human   278 GSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTV 342

  Fly   706 LTPIGNEVVRCINQDEFAGFSF 727
            .:..|       ....|.|||:
Human   343 ASSSG-------ASSAFLGFSY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556
C1_1 252..304 CDD:278556
STKc_nPKC_epsilon 412..729 CDD:270743 140/326 (43%)
SGK2NP_001186193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 1/2 (50%)
STKc_SGK2 39..359 CDD:270754 140/326 (43%)
Nuclear localization signal. /evidence=ECO:0000250 68..78 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.