DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkc98E and gpha2

DIOPT Version :9

Sequence 1:NP_001287577.1 Gene:Pkc98E / 43428 FlyBaseID:FBgn0003093 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_031756486.1 Gene:gpha2 / 100490777 XenbaseID:XB-GENE-492809 Length:125 Species:Xenopus tropicalis


Alignment Length:102 Identity:19/102 - (18%)
Similarity:37/102 - (36%) Gaps:26/102 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 VVHKKCHL------------------SVVSKCPGMRDEQ--PAKVE-MVPAGQRFNVNLPHR-FV 255
            |....|||                  .|::.|.|..:..  |:|.. :|.:|.:.|:....: ..
 Frog    22 VARPGCHLHPFNVTISSDRQGTCRGTQVINACVGYCESSAFPSKYSVLVASGFKHNITSASQCCT 86

  Fly   256 VHSYKRFTFCDHCGSLLYGLIKQG----LQCETCGMN 288
            :...::.....:||...:..|:.|    .||:.|.::
 Frog    87 ISKMQKVKVQLYCGGSRHEEIEIGTALSCQCDMCRLS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkc98ENP_001287577.1 C2_PKC_epsilon 1..134 CDD:175981
C1_1 177..228 CDD:278556 6/32 (19%)
C1_1 252..304 CDD:278556 7/42 (17%)
STKc_nPKC_epsilon 412..729 CDD:270743
gpha2XP_031756486.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.