DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpsf100 and DCLRE1A

DIOPT Version :9

Sequence 1:NP_651658.1 Gene:Cpsf100 / 43426 FlyBaseID:FBgn0027873 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_001258745.1 Gene:DCLRE1A / 9937 HGNCID:17660 Length:1040 Species:Homo sapiens


Alignment Length:257 Identity:57/257 - (22%)
Similarity:89/257 - (34%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 PFQFK---HIQLCHSLADVYKLPAGPKVVLASTPDLESGFTRDLFVQWASNAN---NSI----IL 356
            ||.:|   |..|..|.|..:...:.......|..:.:||....|..:|:|..|   ||:    :|
Human   166 PFHYKRYTHFLLAQSRAGDHPFSSPSPASGGSFSETKSGVLCSLEERWSSYQNQTDNSVSNDPLL 230

  Fly   357 TT---RTSPG-TLAMELVENCAPGKQIELDVRRRVD---LEGAELEEYLRTQGEKLNPLIVKPDV 414
            .|   :.||. |.|.|.:.......|..|.....|:   |.|..|.  |....|.:|..:.:.|.
Human   231 MTQYFKKSPSLTEASEKISTHIQTSQQALQFTDFVENDKLVGVALR--LANNSEHINLPLPENDF 293

  Fly   415 EE----ESSSESEDDIEMSVITGKHDIVVRPEGRHHS-------------------GFFKSNKRH 456
            .:    .|..:|::|        .|||..:|:.....                   ||||  |||
Human   294 SDCEISYSPLQSDED--------THDIDEKPDDSQEQLFFTESSKDGSLEEDDDSCGFFK--KRH 348

  Fly   457 HVMFPYHEEKVKCDEYGEIINLDDYRIADATGYEFVPMEEQNKENVKKEEPGIGAEQQANGG 518
            ..:....:|  .|.:....:..|.|   |...|.|..:.:.::...:..|..:..:....||
Human   349 GPLLKDQDE--SCPKVNSFLTRDKY---DEGLYRFNSLNDLSQPISQNNESTLPYDLACTGG 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpsf100NP_651658.1 CPSF2-like_MBL-fold 7..204 CDD:293851
YSH1 19..400 CDD:224157 30/114 (26%)
Beta-Casp 243..369 CDD:214983 22/80 (28%)
RMMBL 538..577 CDD:284853
CPSF100_C 617..753 CDD:290038
DCLRE1ANP_001258745.1 Nuclear localization region 1..190 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..76
Nuclear focus formation 396..614 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..651
SNM1A-like_MBL-fold 689..844 CDD:293856
DRMBL 914..1019 CDD:311461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.