DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpsf100 and SYC1

DIOPT Version :9

Sequence 1:NP_651658.1 Gene:Cpsf100 / 43426 FlyBaseID:FBgn0027873 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_014822.1 Gene:SYC1 / 854351 SGDID:S000005705 Length:188 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:42/194 - (21%)
Similarity:63/194 - (32%) Gaps:78/194 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 TQGEKLNPLIVKPDVEEESSSES---------------EDDIEMSVITGKHDIVVRPEGRHHSGF 449
            |..|....|::..|||.|.|:.|               .|.|.:.:|                |.
Yeast    42 TATENATKLLMLGDVEVEISASSVSIEWTQKSMISQTIADSIVIMII----------------GL 90

  Fly   450 FKSNK----------RHHVMFPYHE-EKVKCDEYGEIINLDDYRIADATGYEFVPMEEQNKENVK 503
            ..|:|          |:|.::...| :.:..:::|     |.:.|.:..|         .|||||
Yeast    91 CASDKNVLSESELKERNHNVWKIQELQNLFREQFG-----DSFSIDEGIG---------KKENVK 141

  Fly   504 KEEPGIGAEQQANGGIVDNDVQLLEKPTKLISQRKTIEVNAQVQRIDFEGRSDGESMLKILSQL 567
            .....||.                .|.|...|..|.|:.|:.    ..:||.  ||:|.|..:|
Yeast   142 NGSVTIGK----------------SKATIDFSTMKLIDCNSN----PLKGRV--ESILSIGQKL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpsf100NP_651658.1 CPSF2-like_MBL-fold 7..204 CDD:293851
YSH1 19..400 CDD:224157 42/194 (22%)
Beta-Casp 243..369 CDD:214983
RMMBL 538..577 CDD:284853 10/30 (33%)
CPSF100_C 617..753 CDD:290038
SYC1NP_014822.1 CPSF73-100_C <28..186 CDD:416974 42/194 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.