DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpsf100 and SNM1

DIOPT Version :10

Sequence 1:NP_651658.1 Gene:Cpsf100 / 43426 FlyBaseID:FBgn0027873 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_850635.1 Gene:SNM1 / 822280 AraportID:AT3G26680 Length:484 Species:Arabidopsis thaliana


Alignment Length:260 Identity:45/260 - (17%)
Similarity:78/260 - (30%) Gaps:111/260 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 EFAKSQIEW---------MSDKLTKAFEGARNNPFQFKHIQLCHSLADVYKLPAGPKVVLASTPD 333
            :|.|:..:|         :|..:.|.   .::|.||...:|                   .::||
plant    49 DFYKAGSDWSCLVEDEETVSSSVKKM---KQSNLFQIWGLQ-------------------ENSPD 91

  Fly   334 LESGFTR-DLFVQW--------ASNANNSIILTT-----RTSPGTLAMELVENC-----APGKQI 379
            ......: |||..|        .|.|:||...||     |....:.:.:....|     .||...
plant    92 TTKKMKQTDLFQSWGLQKPSPFTSPASNSAKKTTSALGKRRRDSSFSNDSPRPCPFYKKLPGTPF 156

  Fly   380 ELDVRRRVDLEG----------------------------AELEEYLRTQGEKLNPLIVKPDVEE 416
            .:|..|...::|                            :.|...|......:||..:.|    
plant   157 TVDAFRYGCVQGCSAYFLTHFHADHYIGLTKAWSHGPIYCSSLTSRLLRLSLSVNPSSIHP---- 217

  Fly   417 ESSSESEDDIEMSVITGKHDIVVRPEGRH------------------HSGFFKSNKR---HHVMF 460
                 .|.|:|.::...|..::   |..|                  |:|.|:::|:   |.::|
plant   218 -----LELDVEYTINGIKVTLI---EANHCPGAALIHFRLLDGTCYLHTGDFRASKQMQTHPLLF 274

  Fly   461  460
            plant   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpsf100NP_651658.1 CPSF2-like_MBL-fold 7..204 CDD:293851
Beta-Casp 243..369 CDD:214983 22/113 (19%)
RMMBL 539..600 CDD:462191
CPSF100_C 617..753 CDD:463836
SNM1NP_850635.1 SNM1A-1C-like_MBL-fold 142..290 CDD:293831 23/145 (16%)
DRMBL 360..467 CDD:429512
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.