DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpsf100 and Dclre1a

DIOPT Version :9

Sequence 1:NP_651658.1 Gene:Cpsf100 / 43426 FlyBaseID:FBgn0027873 Length:756 Species:Drosophila melanogaster
Sequence 2:NP_001099671.1 Gene:Dclre1a / 292127 RGDID:1306156 Length:1026 Species:Rattus norvegicus


Alignment Length:654 Identity:120/654 - (18%)
Similarity:184/654 - (28%) Gaps:292/654 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ESGLMAYSLALLNNVSYNVIEFAKSQI--EWMSD---------KLTKAFEGARNN-------PFQ 304
            ::|..|.|.....|.|:.:|.....::  |..||         ....|..||..|       |.:
  Rat   374 QAGCSALSRGSTGNDSFQLISRTSGRLSGEDPSDTDAAFLLLSPAPSAVGGATPNCQTTKAKPEK 438

  Fly   305 FKHIQLCHSLADVYK--------------LP-------------AGPKVVLASTPDLESGFTRDL 342
            |      ||||..::              ||             .|.::.|..|.....|.    
  Rat   439 F------HSLASRHQQQKTETSAAGSHTSLPLLLSAMSKPLEKEGGERLPLHPTQSQRRGL---- 493

  Fly   343 FVQW-----ASNANNSIILTTRTSPGTLAMELVENCAPG--------------KQIELDV----- 383
               |     |..||.:...|.|.|...|...|  :.||.              ||:::.|     
  Rat   494 ---WSKGSGAPGANCACSNTQRPSSAPLNKSL--STAPSSPKGSASQPSKKVMKQMDIGVFFGLP 553

  Fly   384 --------RRRVDLEGAELEEYLRTQGEKLNPLI----VKPDVEEESSSESEDDIEM---SVITG 433
                    |.|.            ::|.|.:|::    .:|.:.:..:..|..|:|.   ::...
  Rat   554 PKTQDTSPRERA------------SEGPKASPVVSPSEKRPRLCKRKAQSSLSDLEFDAKNLNES 606

  Fly   434 KHDIVVRPEGRHHSGFFKSNKRHHVMFPYHEEKVKCDEYGEIINLDDYRIADATGYEFVPMEEQN 498
            :|.:.:..|...|     ..|||.                                         
  Rat   607 QHSMELSGERAQH-----RRKRHK----------------------------------------- 625

  Fly   499 KENVKKEEPGIGAEQQANGGIVDND----VQL-----LEKPTKLISQRKTIEVNAQVQRIDFEGR 554
                |...|..|..|..:|.:.:|.    |.|     ..:.|...:||..:.::        |..
  Rat   626 ----KSNSPQEGTYQGRSGHLTNNPELGAVSLRRSKAFARRTPSRTQRGAVNIS--------ESS 678

  Fly   555 SDGESMLKILSQLRPRRVIVIHGTAEGTQVVARHCEQNVGARVFTPQKGEI-------------- 605
            ..|||          ||....:....||           |..|...|.|||              
  Rat   679 GGGES----------RRTCPFYKRIPGT-----------GFTVDAFQYGEIEGCTAYFLTHFHSD 722

  Fly   606 ---------------IDVTSEIHIYQVRLTEGLVSQLQFQKGKDAEVAWVDGRLGMRVKAIEAPM 655
                           .::|..:...::|:.|..:.||..    |.|.. |||     ||      
  Rat   723 HYAGLSKDFTRPIYCSEITGSLLKKKLRVQEQYIHQLPM----DTECI-VDG-----VK------ 771

  Fly   656 DVTVEQDASVQEGKTLTLETLADDEIPIH-----------NSVLINELKLSDF------------ 697
              .|..||:...|.|:.|..|.:..:.:|           .|:|.:....:.|            
  Rat   772 --VVLLDANHCPGATMILFQLPNGAVTLHTGDFRADPSMERSLLASRKVHTLFLDTTYCSPEYTF 834

  Fly   698 --KQTLMRNNINSEFSG------GVLWCSNGT---------LALRRVDAGKVAMEGCLSEEYYKI 745
              :|..::..||:.|..      .::.|  ||         ||:..|...||.|    |:|.||.
  Rat   835 PSQQEAIQFAINTAFEAVTLNPRALIVC--GTYCIGKEKVFLAIADVLGSKVGM----SQEKYKT 893

  Fly   746 RELL 749
            .:.|
  Rat   894 LQCL 897

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpsf100NP_651658.1 CPSF2-like_MBL-fold 7..204 CDD:293851
YSH1 19..400 CDD:224157 41/218 (19%)
Beta-Casp 243..369 CDD:214983 33/160 (21%)
RMMBL 538..577 CDD:284853 6/38 (16%)
CPSF100_C 617..753 CDD:290038 40/173 (23%)
Dclre1aNP_001099671.1 Ustilago_mating <7..115 CDD:114448
metallo-hydrolase-like_MBL-fold 675..830 CDD:304873 37/201 (18%)
DRMBL 900..1005 CDD:284854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1236
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.