DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTB and b4galt1l

DIOPT Version :9

Sequence 1:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001070727.2 Gene:b4galt1l / 768123 ZFINID:ZDB-GENE-061013-84 Length:350 Species:Danio rerio


Alignment Length:333 Identity:109/333 - (32%)
Similarity:164/333 - (49%) Gaps:35/333 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TLIVYLCLPFRFASHYDYIEESKIEGALV------PQVTRNVSQQEVFECTYSEIIAEN------ 75
            :|:|.||....|.:...|:..|....|..      |.:.|.:::|.  ..|.....|.|      
Zfish    16 SLVVLLCFLHIFVTVIYYMRNSDSRPAFAQNQQQRPTIHRKLAEQR--GTTEDSRPAANASSNGQ 78

  Fly    76 ----------RFVYHL-AHYHDAV------QRGAEIRPGGEFRPEGCQARYSTAIIVPYRQREEQ 123
                      |.|..| ..:.|.:      ...:.::.||.|||..|.||...|:|:|:|.|:|.
Zfish    79 ELQICPEEPPRLVGPLRVEFSDPITLEMVRTENSVLQEGGRFRPPDCIARQKVAMIIPFRNRDEH 143

  Fly   124 LHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIG-AQVAAEYGFPCLILHDVDLLPLN 187
            |..:|.|:|..|.:|.:.|.::::.|.....||||.|.||| |:...||.:.|.:..||||:|::
Zfish   144 LKFWLYYLHPILQRQQLDYGVYVINQDGEDTFNRAKLLNIGYAEALKEYDYDCFVFSDVDLIPMD 208

  Fly   188 SGQIYACSERPRHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQINGMSNLYYGWGGEDDDLYER 252
            ...||.|..:|||::.::|.:.|||||...||||.:::..|:.:|||..|.|:||||||||::.|
Zfish   209 DRNIYKCYNQPRHLAVSMDKFGFRLPYTQYFGGVSSLSKEQFLKINGFPNNYWGWGGEDDDIFNR 273

  Fly   253 LQALNIDICRFAMEFSKYTMLKH---KQEQPNANRVALLRSATLRQHADGLNSLVYTEMERRMHS 314
            :.:..:.|.|......:..|::|   ||..||..|...:.........||:|||.|..::.....
Zfish   274 ISSRGMSISRPDGLLGRCRMIRHERDKQNDPNPQRFDRIAHTRETMATDGINSLKYNVVKIEKDL 338

  Fly   315 LFTHILVD 322
            |||.|.||
Zfish   339 LFTKITVD 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 82/217 (38%)
b4galt1lNP_001070727.2 b4GalT 128..346 CDD:132999 82/217 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.